PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10029101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 219aa    MW: 24812.4 Da    PI: 6.2273
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10029101genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.24.7e-1599152558
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L ++l++l++  ++
  Lus10029101  99 RKQRRMISNRESARRSRMRKQKHLDELWSQVVRLRNENHSLLDRLNHLSESHDR 152
                  79*********************************************9987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-1795159IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-1297149No hitNo description
PROSITE profilePS5021711.39297160IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.0E-1399149No hitNo description
PfamPF001701.0E-1299151IPR004827Basic-leucine zipper domain
CDDcd147028.22E-21100151No hitNo description
PROSITE patternPS000360102117IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MLSSGDHQFT GGLHFLPHEQ SFMPDYFPPP HTSVSAARFL QAATGTDTFP MNMHNMSIHD  60
YIINPPANQN YNNNYSPSSL SSSTSDEADE QQMKIIDERK QRRMISNRES ARRSRMRKQK  120
HLDELWSQVV RLRNENHSLL DRLNHLSESH DRVVEENARL KEESSGLRQL LTDLPIGSPY  180
SNESAAMALR ELDDVVRADH HQSSSNDSSI ASSVDLLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111118RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012088083.12e-60PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC22e-38BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A067JK132e-60A0A067JK13_JATCU; Uncharacterized protein
STRINGVIT_01s0010g00930.t013e-56(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16043399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.16e-45basic leucine-zipper 42